同服IP站点列表(304)
- Best CBSE Boarding Schools in Dehradun North India - Doon International Schooldisriverside.com
- Website designing and development company in Navi Mumbai and best email hosting solutions providerwww.sysmic.in
- Harinarayanan Structurals Pvt Ltdwww.harinarayanan.com
- Maine Dekha Hai - A Journey and it's experiences By Shruti Bhargavamainedekhahai.com
- Best CBSE Boarding Schools in Dehradun North India - Doon International Schoolwww.disriverside.com
- LPT SHG Sankul Amrelilptshgsankulamreli.org
- Excel Realty N Infra LTDexcel-infoways.com
- Unknownkrishcastrapping.com
- 403 Forbiddenkhalsacollegeasr.in
- Home - SONETwww.sonetindia.com
- Buy Best Comfort Mattress | Foam mattress | Comfort Mattress - 2022comfort-mattress.com
- Nullinfinitypumps.com
- Visitor anti-robot validationwww.cerveausys.com
- Shree Steelsswrl.com
- Medihauxe Pharma private limitedwww.medihauxepharma.com
- Maxelinks | Tourist Visa & Study Visa Expertsmaxelinks.com
- Painless & Bloodless Circumcision Surgery in Surat (Gujarat) - Elegance Clinicwww.elegancecircumcision.in
- Before and After Results of Hair Transplant Gynecomastia Liposuction Breast Facemakeover in Surat - Elegance Clinicwww.elegancegallery.in
- Best Hair Transplant in Surat Hair Transplant Surgeon Gujarat India - Elegance Clinicwww.elegancehairtransplant.in
- Neeta Training & Consulting Services – Endeavor Successneetatcs.com
- Small Farmers Agri-business Consortitum Kerala – Department of Agriculture Govt of Keralawww.sfackerala.org
- ARF Indiaarfjournals.com
- Suresaa Tea Groupsuresaa.com
- Nullwww.bizlinkz-cfoservices.in
- Suresaa Tea Groupwww.suresaa.com
- Kopal Vani - Kopal Vanikopalvani.com
- Shighrapatan ki dawa - shighrapatan ki dawashighrapatankidawa.com
- 3WM3waysmedia.net
- Shree Steelwww.sswrl.com
- Prime Techno Solution| Home PTSwww.primetechnosolution.com
- Somali Eventswww.somalievents.com
- Nullxyzfoundation.net
- Server upgradesbaalajiexport.in
- Nullsysmic.in
- A K Automation Systemswww.akautomationsystems.com
- Medihauxe Pharma private limitedmedihauxepharma.com
- Buy or Sell Club Mahindra Sterling Holiday memberships - SELL MY MEMBERSHIPsellmymembership.com
- MUDRA FINANCE 8211 Call 9836268796mudrafinanceloan.in
- Ixpert – iPhone & Laptop Repair & Servicesixpertservice.com
- Infensol - Innovative Fenestration Solutionsinfensol.com
- A K Automation Systemsakautomationsystems.com
- Best Yoga Teacher Training in Noida | Sohum Yoga Studiowww.sohumyogastudio.com
- Shop Online on Relifeon – Get the best discount 70 offshop.relifeon.com
- Ixpert – iPhone & Laptop Repair & Serviceswww.ixpertservice.com
- Home | Silver Jubilee Traveller Limited | Silver Jubilee Traveller Limited -www.silverjubileeaviation.com
- Nullzervvostudyabroad.com
- Home | Silver Jubilee Traveller Limited | Silver Jubilee Traveller Limited -silverjubileeaviation.com
- Tweak Talentwww.tweaktalent.com
- Meme Grim Reaper – MemeGrimReaper is your degend friend and buddymemegrimreaper.webizx.com
- Relifeon Service Centrersc.relifeon.com
- Relifeon - Assamassam.relifeon.com
- Relifeon বাংলা - Homebengali.relifeon.com
- Relifeon Hindihindi.relifeon.com
- Trayi Consultingwww.trayi.net
- Kukus Toys - Its A Toy Timewww.kukustoys.com
- VES MODEL CONVENTwww.ves.org.in
- Best cad training institute in Pune- Educad Kothrudeducaddchinchwad.com
- Home - Akshara Makeup Studioaksharamakeupstudio.com
- Best cad training institute in Pune- Educad Kothrudwww.educaddchinchwad.com
- Ganga Suits 8211 My WordPress Bloggangasuits.com
- Home - Cosmetic Surgeon Surat | Dr Ashutosh Shah Plastic Surgeon in Suratwww.surathairandcosmetic.com
- Anvay Enterprisesanvayenterprises.com
- Anvay Enterpriseswww.anvayenterprises.com
- Get best deals on properties in Palghar and Boisar | Monavi Palghar Properties 8211 Right place to find right propertiesmonavipalgharproperties.com
- CHRISTIAN CHAMBER OF COMMERCE AND INDUSTRYccciindia.com
- Best Plastic Surgeon in Surat Hair Transplant Liposuction Gynecomastia Breast Augmentation Circumcision Videos - Elegance Clinic Surat (Gujarat)www.eleganceclinic.in
- Certified Plastic Surgery in Surat Gujarat & all over India - Dr Ashutosh Shah Elegance Clinicwww.drashutoshshah.com
- Home - Cosmetic Surgeon Surat | Dr Ashutosh Shah Plastic Surgeon in Suratsurathairandcosmetic.com
- Personal Finance Blog - Salma Sony CFPᶜᵐsalmasony.com
- Unknownwww.vozichomes.com
- Salma Sony CFPCM 8211 Committed to Helping Our Clients Succeedwww.salmasony.com
- Bhoori Internationalbhooriinternational.com
- Unknownstudioeethetics.com
- Unknownthedagupenansparks.net
- Home || Wetcombwww.wetcomb.com
- RS Carewww.rscare.in
- V**devi Technologiesvagdevitechnologies.com
- Relifeon inrelifeon.in
- Maze2Amaze 8211 Discover your perfect career stream college amp course with India 039 s leading career counsellors Career counselling amp guidance programs for school college students amp graduatesmaze2amaze.com
- AkitaPluto 8211 Akita on Pluto guarantees an immersive experience to it’s holdersakitapluto.webizx.com
- Solario Finance 8211 Solario Financesolario.finance.webizx.com
- Investfolio 8211 Decentralized Solutions for Centralized Tradinginvestfolio.webizx.com
- Digital Agency 2020 8211 Phlox Elementor WordPress Theme 8211 Just another Complete Elementor Demos 8211 Phlox WordPress Theme sitecryptodoggo.webizx.com
- PRIME WORLD is a Leading Designer Importer Distributor most importantly E-tailer of Innovative Home Kitchen Utility Cleaning Products of World Renowned Brandswww.primeworld.in
- Home - Hebron Church Trusthebronchurchtrust.org
- Under Constructioncrayonsmedia.com
- PRIME WORLD is a Leading Designer Importer Distributor most importantly E-tailer of Innovative Home Kitchen Utility Cleaning Products of World Renowned Brandsprimeworld.in
- Home - Prasheekawww.prasheeka.com
- Home - Prasheekaprasheeka.com
- Welcome to PNP Education Trustpnpedusoc.com
- Pheonix tools – Decentralized Solutions for Centralized Tradingphoenixtools.webizx.com
- Happy Artz – Art Brings Happineshappyartz.com
- Zervvo Study Abroad | Overseas Education Consultancy in Indiawww.zervvostudyabroad.com
- Girish Deshpande & Associatesgldeshpande.com
- TNPSC Police Acdemy in Pochampalli Mathur | Kamarajar Academywww.kamarajaracademy.com
- Oasis Global Sea Shipping Lines Agents LLCwww.oasisglobalshipping.com
- Fal Fruit & Co | Best Fruit Catering Company in Chandigarhfalfruitco.com
- NEOVEL Pharma Pvt Ltd | For Better & Affordable Health Careneovelpharma.com
- Lovely Mehendi Art 8211 Lovely Mehendi Artlovelymehendiart.com
- Goweb24 | Website for E-com Personal Website | Free Domain & Hostinggoweb24.in
- Welcome to Amas Medical Services Pvt Ltdwww.amasmedical.com
- Tharangam Mission Action Centre - Homewww.tharangam.org
- MADHU INSURANCE & FINANCIAL SERVICESinsurancemadhu.com
- Tharangam Mission Action Centre - Hometharangam.org
- Mudumalai Resorts - Holiday Wildlife Resorts in Mudumalai Wildlife Sanctuary - Listing of Mudumalai Resorts Hotels Guest Houses Lodges Home Stays accomodation in Mudumalai Masin**udi Thorpally Thepekkadu Bokkapuramwww.mudumalairesorts.com
- Unknownurjetaelectrical.com
- Wilson Philipose – Portfoliowilsonportfolio.site
- Best Software Training Institute Hyderabad | Python | Django Training - V**devi Technologieswww.vagdevitechnologies.com
- Dr Dhaval Dharaniwww.drdhavaldharani.com
- Small Farmers Agri-business Consortitum Kerala – Department of Agriculture Govt of Keralasfackerala.org
- URI Technologywww.uritechnologies.com
- Dr Jugal Kishore – Just another WordPress sitewww.drjugalkishore.com
- Bhoomi Serenity Kharghar New Launch Project by Gajara Developersbhoomiserenity.com
- Dr Jugal Kishore – Just another WordPress sitedrjugalkishore.com
- Nullsysmic.net.in
- Unknownwww.neetatcs.com
- Somali Eventssomalievents.com
- VES MODEL CONVENTves.org.in
- Trayi Consultingtrayi.net
- Qfix | Homep**eadvancesolutions.co.in
- Nullcpcontacts.swamivivekanandacollege.org
- Error 500 (服务器错误)!!1meet.projectvinci.org
- Swami Vivekananda College of Education Aramb**h Hooghly Pin Code: 712602 West Bengal – Education is the manifestation of the perfection already in manwww.swamivivekanandacollege.org
- Swami Vivekananda College of Education Aramb**h Hooghly Pin Code: 712602 West Bengal – Education is the manifestation of the perfection already in manswamivivekanandacollege.org
- Nullcpcalendars.swamivivekanandacollege.org
- Nullbizlinkz-cfoservices.in
- ProDiets | Lakhan Chhabra | Nutritionist | Health Portalprodiets.in
- Namotech Consultancy and Research Centre Pvt Ltdnamotech.in
- Bholenath Developers Ltd – Im**ination To Realitybholenathcos.com
- Bholenath Developers Ltd – Im**ination To Realitywww.bholenathcos.com
- Unknownfunshiksha.com
- Best Botox Treatment and Fillers Treatment in Surat and Gujarat (India) Best Doctor For Botox and Fillers - Elegance Clinicelegancebotoxfiller.in
- Best Botox Treatment and Fillers Treatment in Surat and Gujarat (India) Best Doctor For Botox and Fillers - Elegance Clinicwww.elegancebotoxfiller.in
- Painless & Bloodless Circumcision Surgery in Surat (Gujarat) - Elegance Clinicelegancecircumcision.in
- Venu Rasuriwww.venurasuri.in
- THE LIBERAL STORE – Apparel Brandtheliberalstore.in
- URI Technologyuritechnologies.com
- Welcome to Amas Medical Services Pvt Ltdamasmedical.com
- Jugaad Dealjugaaddeal.com
- Welcome to the Hotel Amberhotelamber.co.in
- PG Technologies | Web Hardware and Networking Services in New Delhi Indiapgtechnologies.in
- PG Technologies | Web Hardware and Networking Services in New Delhi Indiawww.pgtechnologies.in
- Nullshubhamstock.com
- HONEY GLASS SOLUTIONS – Just another WordPress sitedeeptimberkarnal.com
- Elegance Podcast – My WordPress Blogelegancepodcast.com
- Dantewada Timeswww.dantewadatimes.com
- Maurya Print O Packwww.mauryaprint.com
- Computer's Galaxycomputersgalaxy.in
- Liposuction Surgery in Surat Gujarat India - Elegance Clinicliposuctionindia.in
- Journal of High-Frequency Communication Technologiesbluemartinpress.com
- Callidus Pixels – Excellence in every Pixelcalliduspixels.com
- Unknownvozichomes.com
- Computer's Galaxywww.computersgalaxy.in
- Unknownrawmen.in
- Bawa Kitchen – Bawa Kitchenthebawakitchen.com
- PV College of Nursing – A Great Place to Think Big Thoughtswww.pvcollegeofnursing.com
- Cocobellacocobellaofficial.com
- Cocobellawww.cocobellaofficial.com
- Ac Repair near me Services in puneurjeta.com
- Intario Logistics – Road Transportation Servicesintariologistics.com
- Nullastrologerjairam.com
- Lakshmi Hospitality Concernswww.lakshmihospitalityconcerns.com
- Home - SONETsonetindia.com
- Elegance Vidhyalay – The Future Begins Here!elegancevidhyalay.in
- Crescendo Studiocrescendostudio.in
- Rajoo Cabs Mylapore Chennai Tamil Nadu India : cab booking taxi bookingrajoocabs.in
- Account Suspendedvilla-akasa.in
- WordPress &rsaquo Errorujjwal.in
- Breast Augmentation Breast Reduction Mastopexy Mammoplasty Breast Reconstruction Surgery Treatments and more - Elegance Clinicbreastsurgeonindia.in
- Breast Augmentation Breast Reduction Mastopexy Mammoplasty Breast Reconstruction Surgery Treatments and more - Elegance Clinicwww.breastsurgeonindia.in
- Elegance Clinicaelegancerhinoplasty.in
- Gynecomastia Surgery in Surat Gujarat India - Elegance Clinicgynecomastiaindia.in
- Best Hair Transplant in Surat Hair Transplant Surgeon Gujarat India - Elegance Clinicelegancehairtransplant.in
- Under Constructionifiber.in
- Indexvincare.co.in
- Nullelegancegallery.in
- Hak Computer Centerhakcomputers.in
- CISRS Bangalorecisrs.in
- SSNC Dr B R Ambedkar Smaraka First Grade Arts & Commerce College - One of the Top Commerce and Arts Best Colleges in Hublissncdrbraakkdegreecollege.in
- SSNC Dr B R Ambedkar Smaraka First Grade Arts & Commerce College - One of the Top Commerce and Arts Best Colleges in Hubliwww.ssncdrbraakkdegreecollege.in
- Elegance – The Surat Hair And Cosmetic Laser Clinicdrashutoshshah.in
- Certified Plastic Surgery in Surat Gujarat & all over India - Dr Ashutosh Shah Elegance Clinicdrashutoshshah.com
- POPUPplanethollywoodthane.com
- Kohesi Bond | Epoxy Adhesives Sealants & Coatingssitetestdomain.com
- Unknownfourleafhotels.com
- Unknownberryseek.com
- Unknowneleganceclinic.in
- Elegance Cliniceleganceplasticsurgery.in
- Dr Pillai's Ayurveda – Ayurvedic Hospitaldrpillaisayurveda.org
- gkg News | Breaking Newsgkgcoingkg.co.in
- Unknowneasyfithearing.com
- Unknown116.206.105.245
- PEMF Canadapemfcanada.ca
- Unknownsuratdiabeticfootcare.in
- Sanjar The Furniture Worldsanjarfurniture.com
- Nullsarveshingenieur.com
- Aanchhari Times – News Portalaanchharitimes.com
- Nullraisingsungroup.com
- 503 Service Unavailablecpcontacts.suresaa.com
- 503 Service Unavailablecpcalendars.suresaa.com
- Suresaa Tea Groupmail.suresaa.com
- Digital MarketingCCNACCNPMobile Phone Repair WebDesignAutocaddatacomes.com
- 503 Service Unavailablecpcalendars.planethollywoodthane.com
- 503 Service Unavailablecpcontacts.planethollywoodthane.com
- Nullwebdisk.planethollywoodthane.com
- POPUPmail.planethollywoodthane.com
- Nullrixapps.com
- TACKtackweld.co
- Nullwww.crayonsmedia.com
- Taxileaderwww.francetaxi.taxileader.fr
- Relief surgico Coming soon!reliefsurgico.com
- Unknownidecodekit.com
- Home - Job Zeniththejobzenith.com
- Mr Y Solutionsmrysolutions.in
- Nullpacknwrap.in
- The RD Mart – Retailer & Wholeseller at UAEtherdmart.com
- Home - AD CARGOwww.adcargo.in
- Best Ac Service And Repair Services n Pune @9370669299urjeta.in
- Galaxy AIgalaxyaicafe.in
- Pink Pigeon – Natural Cosmeticspinkpigeon.in
- Advance Solutionswww.advancesolutions.co.in
- Oye Cakesoyecakes.com
- ARF INDIAwww.arfjournals.com
- bdcbipsbidadi.bdccollege.in
- Excel Infowayswww.excel-infoways.com
- NPOS – Cloud Based POS Softwarenpos.app
- Top Vedic Astrologer In New York USA | Best Indian Astrologer in New Yorkastrologervijayji.com
- Top Vedic Astrologer In New York USA | Best Indian Astrologer in New Yorkwww.astrologervijayji.com
- Hotel Help Desk - Your Trusted Corporate Travel Partner with 13 Years of Experiencehoteldeskglobal.com
- TMS – The Muscle Studiothemuscle.studio
- Bayasoft – weaving smart solutionsbayasoft.in
- ECoSuiTe – Technology Consulting for Sustainabilityecosuite.co.in
- Bayasoft – weaving smart solutionswww.bayasoft.in
- Unknownwavero.com
- Unknownclassicinterio.com
- Unknownjayfilaments.com
- Unknownexelcare.co.uk
- Unknowncatterfly.travel
- Unknownnexim.ae
- Unknownwww.urbancast.knneducation.com
- Unknownyindu000.com
- Unknowndelhimithaihouse.com
- Unknownwww.sysmic.net.in
- Unknownraisingsungroup.com.evega.in
- Unknownteghindia.com
- Unknowncooperativepharmacy.org
- Unknowncognoscentix.com
- Unknowndataxs.in
- Unknownbrooksbanquets.com
- Unknowncandleadvisors.com
- Unknownastrosoul.net
- Unknowndaraladaine.com
- Unknownwww.amaairasingh.com
- Unknowndtriumphlogistics.com
- Unknownengelsizedebiyat.com
- Unknownevega.in
- Unknownhaileads.com
- Unknowngufofitout.com
- Unknownsanatansanghtrust.org
- Unknownglobalgoanassociation.com
- Unknownupdeshrana.com.sanatansanghtrust.org
- Unknownwww.website-projects.com
- Unknownwww.kidmeapp.evega.in
- Unknownwww.truevaluemotorhouse.co.uk.crayonsmedia.com
- Unknownwww.updeshrana.com.sanatansanghtrust.org
- Unknownamaairasingh.com
- Unknownasharlockey.com
- Unknownmail.advancesolutions.co.in
- Unknowncpcontacts.shashwatiinpiles.com
- Unknownbetacosmicvent.in
- Unknowncpcalendars.jetformwork.in
- Unknownbdccollege.in
- Unknowncpanel.jetformwork.in
- Unknownprimetechnosolution.com
- Unknowntweaktalent.com
- Unknownoasisglobalshipping.com
- Unknownmudumalairesorts.com
- Unknownurbancast.knneducation.com
- Unknownwebsite-projects.com
- Unknownkidmeapp.evega.in
- Unknowntruevaluemotorhouse.co.uk.crayonsmedia.com
- Unknowncelestialholidays.in
- Unknownconceptdecors.in
- Unknownkukustoys.com
- Unknownharinarayanan.com
- Unknownitechnologiesedu.com
- Unknownmail.mdfabs.com
- Unknownmdfabs.com
- Unknownrealpathacademy.com
- Unknownmleena.com
- Unknownbesteve.co.in
- Unknowncpcontacts.cognoscentix.com
- Unknowncpcontacts.copyest.com
- Unknownnexleap.com
- Unknownsoftware.namotech.in
- Unknowntest.rawmen.in
- Unknownansaarclinic.com
- Unknownurjetaelectricals.com
- Unknownpowerxbharat.com
- Unknownwww.wavero.com
- Unknownshivanyaexpressnews.com
- Unknownhotelriseanddine.com
- Unknownwatergenindia.com
- Unknownamsbim.com
