同服IP站点列表(105)
- birdhouseorgbirdhouse.org
- scot hacker's foobar blog – Tilting at windmills for a better tomorrowblog.birdhouse.org
- The Birdhousearchive.birdhouse.org
- Stuck Between Stationsstuckbetweenstations.org
- Wendellaswendellas.com
- birdhouseorgwww.birdhouse.org
- Unknownwww.jerrysbooksucks.com
- Hazelton Designhazeltondesign.com
- Carl Stone Event Schedule Gatewaywww.sukothai.com
- Nullwww.burningmoth.com
- Carl Stone Event Schedule Gatewaywww.rlsto.net
- kestaskuliukascom Kestas home p**ekestas.kuliukas.com
- access & sql server databases – Microsoft database solutionsalgis.kuliukas.com
- General Errorwww.waterside-hypotheses.com
- Just another WordPress site – Just another WordPress sitekuliukas.com
- Just another WordPress site – Just another WordPress sitewww.kuliukas.com
- Nullwww.classic-wbs.net
- River Apes (… Coastal People) – A Waterside Hypothesis of Human Evolutionwww.riverapes.com
- Nullwww.dillatime.com
- Matthew Sperry in Memoriammatthewsperry.org
- Nullwww.dannyvampire.com
- Nullneddimitrov.org
- 8212 8212 8212 8212 8212 MelCo Health 8212 8212 8212 8212 8212 Eating Clean Inspiring Awesome 8211 8211 Melanie Cohenwww.melaniecohen.com
- Legacy Ensemble - Homewww.legacyensemble.com
- Homewww.holmlegacypublishing.com
- Homeholmlegacypublishing.com
- Legacy Ensemble - Homelegacyensemble.com
- Home | PROPERTYZZ COMwww.propertyzz.com
- Mark Boniface - Digital Media Professional amp Solutions Director at Infinity TrackingMark Boniface | Digital Media Professional amp Solutions Director at Infinity Trackingwww.markboniface.com
- Confidence Landscaping Incconfidencelandscaping.com
- Domain is Parkedbleen.net
- Carl Stone Event Schedule Gatewayrlsto.net
- Unknowndannyvampire.com
- joasuorezcomjoasuorez.com
- River Apes (… Coastal People) – A Waterside Hypothesis of Human Evolutionriverapes.com
- Nulltarraccas.com
- Stuck Between Stationswww.stuckbetweenstations.org
- Eating Clean Inspiring Awesomemelaniecohen.com
- Nullburningmoth.com
- Nullclassic-wbs.net
- Fraser Valley Chem-Dry - Surrey carpet cleaning Surrey carpet stain removal surrey carpet cleaning white rock cleaning services white rock leather restoration north delta pet stain removalsurreycarpetcleaning.ca
- Nullpropertyzz.com
- The Dude's Review | Just another WordPress sitewww.thedudesreview.com
- odmarkorg is almost here!odmark.org
- Unknowncarlsto.net
- The Dude's Review | Just another WordPress sitethedudesreview.com
- Nullfiftythewanderlust.com
- Nullwanderlustfifty.com
- Unknowndillatime.com
- KIMBERLY BRADLEY – Kimberly Bradley is a writer and editor based in Berlin and sometimes Viennakimberly-bradley.com
- Nullfraservalleychemdry.ca
- Fraser Valley Chem-Dry - Mission Carpet Cleaning Maple Ridge Carpet Cleaning Mission upholstery cleaningmissioncarpetcleaning.ca
- Firelight Creative Mediadouglasnagel.com
- Firelight Creative Mediafirelightcreativemedia.com
- Unknownthenewprivateparty.com
- Unknowncarlstone.tokyo
- Unknownonline.rqmtutorial.com
- Unknownboncx.com
- Unknown67.205.4.140
- Unknowncareers.rqmtutorial.com
- Unknownwww.matthewsperry.org
- Unknownhakmon.com
- Unknowndrdeedeephd.com
- Unknownenjoyall50states.com
- Unknownfiftywrites.com
- Unknownwww.barnabasteam.com
- Unknowncounter.daraross.com
- Unknownwww.counter.daraross.com
- Unknownmichaelvelez.com
- Unknownwhatsonthedyno.com
- Unknowncsz2.sukothai.com
- Unknownswhoa.us
- Unknownmarkboniface.com
- Unknownbarnabasteam.com
- Unknownhbspeed.com
- Unknownyournewmiamihome.com
- Unknowntwodollarparadise.com
- Unknowntbihome.dreamhosters.com
- Unknowndavidstoiber.com
- Unknownwww.jenniferformayor.dreamhosters.com
- Unknowneverythingcharles.com
- Unknownchainreactionbrewingco.com
- Unknowndrmichaelvelez.space
- Unknownparttimedruid.com
- Unknownwww.firelightcreativemedia.com
- Unknownwww.algis.kuliukas.com
- Unknowncsz4.sukothai.com
- Unknownwww.csz4.sukothai.com
- Unknownhowserholdings.com
- Unknownwww.howserholdings.com
- Unknownjerrysbooksucks.com
- Unknownwww.bleen.net
- Unknownwww.webdiplomacy.com.au
- Unknownphotowhimsy.com
- Unknownwww.online.rqmtutorial.com
- Unknownihategmail.com
- Unknownwww.kourdi.com
- Unknownwww.csz3.sukothai.com
- Unknowncsz3.sukothai.com
- Unknownminuetproductions.com
- Unknownstemcouncil.org
- Unknowncocktailexplorer.club
- Unknownfraservalleycarpetcleaning.com
- Unknownhel-mart.com
- Unknownwedding.minuetproductions.com
